<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11432

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDFPGGATTNIHLIDGFSTIYWRIYTEESGIATHPQEGPANGYTILKHLGRLKNLEAQLRHIGCLASCPRRLGLWVFSPTPTFESLGPVYITDGDVETTKIFLNTTTLKVSASGSIACQELIKGLSSETQNQQGSLPTPSQRPQQAQPSARRSDGYSSSVAVYSAFISAVTGALSLHLVRTYGALPIGSRTLFTAVDNIGYESPRIDNEGLFSSPSLTTLNVQLNAPGTLTVSTQTIIQAGITRLSSPRDDISDLFRVQPGADLWLCPNGAIARLVTANIESPTVPSPGFPASGDTLAKRMQWKLDVVQWLTNFGLHIDSIDEEPWVEVEVWEPFFARLAGEAWRQSDEPQSALPLKRMLWPARFCFRRTGLPIRSAWPEAPLEEPLEFAERWSSDAGSMKLALPSQSVPTFEESQPKDEGMSPPRVDHGDHLESLSRMAQYPDLQNTNLVYPTPPEGATAAGANIPIQHDAYPDSDLLSPEVPHDTKPLPSSGPSPNVDIGTGHYDASDDDDLFGEMNDKDFGSKGITDADFSFFDDDDQDLGDMADPMLVDQPQEIPQEPVDTIHTKHEPPHVQDLPAAAVSPEAPKVEDEPKPEETSISMKDDPEPADEPMELEESSEPSQGPPSQTISPPLSPVEIKKILFPGSQTEDRRQSQEDQTQQGHYQPVAFQRKLGAWDQKYGAAGKFWFSAGGAINPSVNDLNEIPTVGLPNRARTSISARNKPVAKDFLQAVEDERERDSSDSTESSSEEEEDSDDLPFDHASTPVALPQLKRKRVPSESDIQSAASPAISSVVADGGTGSKAENITFLGNFLSNFSDWTFTGYFSALQIQQLPVLIRREEQIPIAQLLVDQITQSSLNHSLGQQVGLFALESEGTSFTECFDDVAFMGKIQKLDLKGYTSLQEDKTQSSSQSQQPTKESSKNSISKLCAPHLRVRRGKDYLETLPPAMSFWETFGLEPAHGSKDISAYCIHPQAAGQAAEAFLHRFGLSYESCNFGTHSRGDNSTGFDNGLKSWDSESSGYTSMMQSLLGLCEELAAELSQADVPTTNNSVVYIINPFPHAAALADICAAFWNLFQQLVADAERRQSKQVNEVVLQIIPMEFVMSEESMVMPTQTEYVNLALEVYSRCRPKDAESNPLLCAPAILLAENLPKNLNFRLSPDKVSPLQDGRSLHIAYSKSCDQRWVSAAWSDGTGSLQTSMSYCLRYRNRGSSRAVSEVRNEIWATTKHIMDKFQARWKVVLVSTDPMDPDEVDAWSNLAEQQNKMRPASLELTIITVNTIPDLTLNTPASSMSSGVLNPHFSSTPVSTPNPNTSIASPEQAGNAPTPSAVYNASTPTEPSLEPDSDVVLTDVCDDSWAVILSHRLNASPHVTELRPALVSGYLLRRKGATDSEGVFSMTVNLLYSQRPAISHESVLGDILAMYRDLSCLARARGMRSVQGNTLPWHIATALRAQELLSYVF
Length1464
PositionKinase
OrganismPenicillium subrubescens
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.409
Instability index59.55
Isoelectric point4.74
Molecular weight160363.99
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11432
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     134.75|      32|      59|     299|     332|       1
---------------------------------------------------------------------------
  257-  286 (36.45/17.95)	.RVQPGADL..WLCPN.....G.AIARL.....VtaniESP....TVP
  299-  332 (59.47/39.38)	KRMQWKLDVvqWLTNF.....GLHIDSI.....D....EEPWVEVEVW
  357-  393 (38.83/19.59)	KRMLWP.......ARFcfrrtGLPIRSAwpeapL....EEPLEFAERW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     113.28|      31|     204|     800|     831|       2
---------------------------------------------------------------------------
  800-  831 (53.70/31.88)	GTGSKAENITFLGNFLSNFsDWTFTGYFSALQ
  999- 1029 (59.57/31.78)	GTHSRGDNSTGFDNGLKSW.DSESSGYTSMMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     101.00|      24|     204|     399|     425|       3
---------------------------------------------------------------------------
  136-  157 (28.13/ 6.33)	LPTPSQR........P..QQAQPsarRSDGYS..
  402-  425 (41.78/21.08)	LALPSQS.......VPTFEESQP...KDEGMSPP
  453-  482 (31.09/10.68)	.PTPPEGataaganIPIQHDAYP...DSDLLSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.21|      18|     204|     930|     953|       4
---------------------------------------------------------------------------
  930-  953 (28.37/36.48)	LCAPHLRVrrgkdyLETLPPAMSF
 1142- 1159 (32.85/22.87)	LCAPAILL......AENLPKNLNF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     117.24|      34|     204|     555|     590|       5
---------------------------------------------------------------------------
  555-  578 (36.45/13.94)	...............PQEIPQ.EPVDTIHTKHEPPHVQDL
  579-  608 (27.65/13.83)	PAAavSPEAPKVedePK..PE.ET..SISMKDDPE.....
  609-  643 (53.13/24.29)	PAD..EPMELEE...SSEPSQgPPSQTISPPLSPVEIKKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     159.64|      49|     308|    1046|    1094|       8
---------------------------------------------------------------------------
 1046- 1094 (83.82/61.68)	DVPTTNNSVV..YIINPFPHAAALADICAAFWNLFQQLVADAERRQSKQVN
 1354- 1404 (75.82/54.95)	DVCDDSWAVIlsHRLNASPHVTELRPALVSGYLLRRKGATDSEGVFSMTVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.95|      28|     308|     183|     212|      10
---------------------------------------------------------------------------
  183-  212 (44.83/36.34)	GALPIGSRTLFTA.VDNIGyeSPRIDNEGLF
  228-  256 (43.13/27.47)	GTLTVSTQTIIQAgITRLS..SPRDDISDLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.51|      27|     158|     491|     535|      11
---------------------------------------------------------------------------
  504-  535 (42.62/46.35)	GHYDASDDDDLFGEMnDKDFGSKGitdaDFSF
  664-  690 (52.89/19.65)	GHYQPVAFQRKLGAW.DQKYGAAG....KFWF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11432 with Med13 domain of Kingdom Fungi
Unable to open file!