<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11428

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGVIMEYHNGEGSVRRPGLNEATNGAHGSMGSEKFGQRPTLSNGPVHVNGTGREADSSNQLSKATQRMEELTITPYEIPHITQGFFSFGTLVNRAVQNCWNELSELISELATIQVPPDHSTAHGAIGKSPGNQSAQNMHKKLKILEWGHAKRAEFIKLLVLSDWSRQASEVSRLIDIQGFIRTRHQAYSNAMNFLGVMKQDLVRAQVANPDLKTALEVLAKGRVASLPDFGYKPPKPLSARATLKKLHKINRIISARLILQDQVPHALRQYRVHDGRVTFTVAGEFELDLSVAQEAKTSQFFFVDIRFLFTPSSPIPKGRILNELEVEVNRILYNDGLLACFNFLHGLVLTNKINTLFRQAQELARGLWSDLLRIELLHRTLVVQYWPSRAGPKSWIEIGVRRSSPDSSIKVPHLNLRWMRDSQQAHSVDIKFDTDVLSMERILRSVIALHTSHVLSSAYATLRKHLLFANHVLSLKGQLSSSEPSDCYLELQLTTTRHLRVFIEPQSGAITLSGTPSVVERLEGDRAPAKPAVEELLTRIARLRCATAVEEIESGTKALGLESVNHRAVGLDIRKLFPPNTVRSAFFTHQTWDRRWIAAATSSMDGDQWWLVQLRPEARRSALPYGVTDGTSSPALAHAVSSTLMGTGRRFDYTACAELVYGLTGILAIYANARCLTDLPGVRFQPTLEKLELGSDLQVPDLYIDYKRSSLPAAFQIPLPASQLQKDSFVGSTICLSFQGVDRKSNSAILVASGTLQRRIKSLNMLISQVDPDIIVQDKGGGFALRLVVPAGQSAVVGLFERLQRLDCVIYILQKLIQKGMELQAMSLSQFIFLYGPEKKLRATFGIDVSGPSPSAPINIPQIISQGTPIFSLRLKLSFDSPSPHRRIQESLGVMLNHRFAEVGIDPILALMADTFPLLRSLDQMITKPAQSESALVHVIVRSPTVFQIHYPKLRYRFRLSAHLRQGRIEWLLEDTNRPPPVEPSQVSAVVRENVYNAKGDGWQGLGDGARASTHRVGDLLSKLHECLGTCQPVPEPEPVLQSTNGNTKPAQSKPASKSAEEKPAPPPQAKPKTTSPKKKKVAGNNDVITID
Length1094
PositionTail
OrganismPenicillium subrubescens
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.212
Instability index49.80
Isoelectric point9.50
Molecular weight121168.73
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP11428
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.92|      14|      15|    1052|    1065|       1
---------------------------------------------------------------------------
 1052- 1065 (22.35/11.00)	PAQSKPASKSAEEK
 1069- 1082 (24.57/12.79)	PPQAKPKTTSPKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.36|      11|      15|     203|     213|       2
---------------------------------------------------------------------------
  203-  213 (19.05/11.46)	LVRAQVAN.PDL
  220-  231 (15.31/ 7.68)	LAKGRVASlPDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.87|      11|      15|     528|     538|       3
---------------------------------------------------------------------------
  528-  538 (18.89/12.50)	RAPAKPAVEEL
  544-  554 (18.98/12.60)	RLRCATAVEEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.12|      13|      14|     655|     668|       5
---------------------------------------------------------------------------
  655-  668 (19.57/14.41)	YtACAELVYGLTGI
  672-  684 (24.56/13.52)	Y.ANARCLTDLPGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.18|      13|     121|     690|     704|       9
---------------------------------------------------------------------------
  690-  702 (20.65/15.99)	LEKLELGSDLQVP
  708-  720 (22.53/ 9.48)	YKRSSLPAAFQIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.90|      14|      15|     233|     246|      10
---------------------------------------------------------------------------
  233-  246 (24.82/15.62)	YKPPKPLSARATLK
  249-  262 (23.08/13.99)	HKINRIISARLILQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.85|      15|      15|      29|      43|      11
---------------------------------------------------------------------------
   29-   43 (26.04/19.26)	GSMGSEKFGQRPTLS
   45-   59 (25.81/19.01)	GPVHVNGTGREADSS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP11428 with Med14 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) CQPVPEPEPVLQSTNGNTKPAQSKPASKSAEEKPAPPPQAKPKTTSPKKKKVAGNNDVITID
2) MPGVIMEYHNGEGSVRRPGLNEATNGAHGSMGSEKFGQRPTLSNGPVHVNGTGREADSSNQLSKATQRME
1033
1
1094
70

Molecular Recognition Features

MoRF SequenceStartStop
1) QAKPKTTSPKKKKVAGNNDVITID
2) SKSAEEK
1071
1059
1094
1065