Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRTPSTIFPAGPLSPSSPAAGSALKESRQLPVSSDHIPQTPTSPPLMSVSDQNNVSNFTSSQASPNQATIHHHPPHTSSPPSSTPMSTQASQQPTVSTTNSFPTPASSVSGHLAHMTSAEDTDHKALHGGTQETTRNMGDGSDYQTTEHRRTDHDRHPLKTASAVAGVHDFATGLSSDPDAMDLDNEPAPRGLPRNLGLDSLQKEFTSAFHLCKSSPIATGPDPSWDLISLYGLGSVAQSVARIHPVTGEKINRLRKSYEGKLKPLGLAGKNKPIKQDSSKEGSLRYLTLWPEEEWQNQKVFGKQIKTADMDSALLSLQNNAMQLQPGMAPNNDFWEDVLGLEKPAKAPGPSDAGKKAVPAPSGRLGTQAGMTGGAGAQDFGDRARPSRGRKRHYDDNSFVGYGEGYADDDDDTGFYSNGEGTGKKKRKKWDRKSLGSHPSVLLWVRQSKTLAYYIALDRFKRKVK |
Length | 468 |
Position | Head |
Organism | Penicillium subrubescens |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.810 |
Instability index | 47.78 |
Isoelectric point | 8.83 |
Molecular weight | 50466.33 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11424 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 344.10| 106| 140| 177| 305| 1 --------------------------------------------------------------------------- 177- 293 (176.34/112.98) LSSDPDAMDLDNEPAPRG..LPRNLGLDSLQKeftsafhlcKSSPIATG....PDPSWDLISLYGL..GSVAQSVA.RIHPVTGEKINRLRKSYEGKLKplGLA...............GKNKPIKQDSSKEGSLRYLTLW 318- 447 (167.76/74.09) LSLQNNAMQLQPGMAPNNdfWEDVLGLEKPAK.........APGPSDAGkkavPAPSGRLGTQAGMtgGAGAQDFGdRARPSRGRKRHYDDNSFVGYGE..GYAdddddtgfysngegtGKKKRKKWDRKSLGSHPSVLLW --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 146.75| 43| 49| 2| 46| 2 --------------------------------------------------------------------------- 2- 44 (74.74/33.09) SDRTPSTIFPAGPLSPSSPAAGSALKESRQLPVS...SDHIPQTPT 52- 97 (72.01/27.19) SDQNNVSNFTSSQASPNQATIHHHPPHTSSPPSStpmSTQASQQPT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKKRKKWDRKSL 2) KTLAYYIALDRFKRKV 3) LRYLTLWP | 427 452 287 | 438 467 294 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab