<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11415
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MVSPQTPGPAPDSPRSSQSPVPEGHQGNLELELLGLANALYNLGTTVINDSTKERDKPGGGKQVGLRVNQVVQHLSTVDNMALDTRTMIPMQILTDIDNARNPMQLTRERLERTATENQFMNGKIAAIASYRDYLNEALCQNFPELEELLRPASDAVVAGTPSQLAHEIVPAIADYQYNISDTHKDIEGTPISFAEPTAQQNSPNRQPCLSLYRKPTNNSRQVTGSNNPNIYAHITQHILRLLNTNVDGKRKIMYALTEIKGVGRRYSNIVCKKADVDLNKRAGELNSDELERIVTIMQNPTQFKIPTWFLSRQKDIVDGKDYQILSNNVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKRG |
Length | 380 |
Position | Middle |
Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.681 |
Instability index | 37.25 |
Isoelectric point | 9.48 |
Molecular weight | 42605.76 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
ribosome GO:0005840 IEA:UniProtKB-KW
|
GO - Biological Function | RNA binding GO:0003723 IEA:InterPro
structural constituent of ribosome GO:0003735 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
translation GO:0006412 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11415
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.26| 27| 83| 241| 267| 1
---------------------------------------------------------------------------
241- 267 (47.40/28.52) RLLNTNVDGK.RKIMYALTEIKG.VG.RRY
324- 353 (33.86/18.71) QILSNNVDSKlRDDLERLKKIRAhRGlRHY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.82| 17| 43| 116| 132| 5
---------------------------------------------------------------------------
116- 132 (29.68/18.72) TENQFMNGKIAAIASYR
161- 177 (30.13/19.09) TPSQLAHEIVPAIADYQ
---------------------------------------------------------------------------
|