<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11409
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MASFPKVTSNQGIAQNGASMSSMLLGPLNEMETLAQTLFLSLTPGQVKPPAPRVDAFLACDQALAAAVNLSYKHQIKQRKIERLKAEILELDSRWRQICIELEMEKRELDGMIEEADERLESIEQAKKASIPYPELLAYAQSLSAFTSAPPNMPDLSLPGQPPPPMFFPPFPNEEKMRRGHLNAEAPLGQLGETHSVGQAPVASPTQNLEPGINPYRHDLRGGPSQFFDLDLDLNPDL |
Length | 238 |
Position | Middle |
Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.403 |
Instability index | 57.33 |
Isoelectric point | 4.93 |
Molecular weight | 26238.65 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11409
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.23| 11| 18| 205| 215| 2
---------------------------------------------------------------------------
205- 215 (22.10/13.94) PTQ..NLEPGINP
224- 236 (16.12/ 8.27) PSQffDLDLDLNP
---------------------------------------------------------------------------
|