<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11405
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQTMHTGTSVANEAEELKRFTGVEFAVVHAQPPFFFIIHKRERLSPEEVKPLAAFFVMNNRIYQSPDLYTVLSNRLLTSLYSIQSTLDSLRTHRPDYTPRTGFVWPIVDPSLAEDAGKKQEDTSTNEVGGMSEAPTKQDATASLGVPKRPQNNTLLMNAMHATAAHSSASLASLALAPTVESVLPDPAASSASRMSATPAPVVSRVATPKPIHQEPPPKAAPGGGKKKRKRTMVMASENA |
Length | 240 |
Position | Head |
Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.370 |
Instability index | 59.36 |
Isoelectric point | 9.33 |
Molecular weight | 25943.24 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11405
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.41| 23| 26| 165| 187| 1
---------------------------------------------------------------------------
164- 186 (37.70/19.47) AAHSSASLASLALAPTVESV.LPD
187- 210 (34.71/17.43) PAASSASRMSATPAPVVSRVaTPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.57| 13| 18| 35| 47| 2
---------------------------------------------------------------------------
35- 47 (24.07/17.51) FFIIHKRERLSPE
55- 67 (25.50/18.93) FFVMNNRIYQSPD
---------------------------------------------------------------------------
|