<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11401
Description |
Uncharacterized protein |
Sequence | MLQELSHMDRITQLQDEIQQLLMIMSTSIAYLTNRTNFIQVSPEIPITKQRNPDKYDTPDVFEANKKELVTDLIRKAKQVEYLINSLPEPEPEEIQAQRLQQLEDEMQLANTEYIQAVNRLKALHEQVTELLRSMLTEVNAGLVDDTNDSIDAGKEGNIMVNSRDWDVSMAL |
Length | 172 |
Position | Middle |
Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.510 |
Instability index | 45.46 |
Isoelectric point | 4.47 |
Molecular weight | 19801.21 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11401
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.03| 16| 18| 91| 106| 2
---------------------------------------------------------------------------
91- 106 (27.62/14.21) EPEEIQA.QRLQQLEDE
111- 127 (23.41/11.31) NTEYIQAvNRLKALHEQ
---------------------------------------------------------------------------
|