<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11400
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MNSGPSTSNGMSVDKMPEKVDPYPIVNGVHLNGDVEPSIEQLERELPEVFDGQIPLGDILSRVMQAIYMELTEMSETLPNMSDAARKRTLADWVVKTKKQVVKLYAIVKWSRDADTVQKCMNITAFLMDQNRQFEDAIQGLTYARESLDPARLRNHDLLTSLDVLTFGTYKRLPTRIKKSIIPPTPLTDAEVIKTLIGIQDAIQFRLRLNEVTPVEMSRQRIANGRVYFTIPKLFECSLTLKGAQPKDSWSFLHVEFLINIGGDVNVTQEFPRRPTGLMHGFIKEEVDRQLELYTPKPPPDFLLPGAEPPPAAPELPEDVVDTPLIRLFNFLQMMSMSYQLEALFFQATRMRSLGWAEFLNVSITPNRKVLAVSYWIRKPPVVRLPPKLAVPLHGGTVTISMVEGVRTSHTSSSKAKVLAELQYASKLGSKRPSDKVESLKFEVRWEPTPNAIGIHIPPEEYLLPTGMLLVDADNLDFEAMLRKIIHKHVNIILTRIQYQLQHTGRSGFAAPGVLTFIEDGEFQALKVLLCADKYILVSLDPRTGRFTLRDVGDLAATMHGLRLLRFADKINETPAQIFNALVSIRLHTIIDLIEQKAQYLGLQSFRSRNFAQTEMAKLGPHRGSIYIQLESHPTHYLVIMISDEDFKYALINTQIVRTTITTSMVMGDIAWLDFSRLRNDDLTISVHADRPDSRPVLKRGRSDEKVLPVEQPSAGFHLETQVLREIYSYCCARVAYMNVEIQFKTRGIPFTHVNHTASTSVSPELAYIQSSLARSVPGLCVQSSDILSGAPAAEAAMPNIRVIPLNWWSEKKAQVVTCVKLKYVQQPMGKSAGTSTVIRPSKRIIYDTTEAVVSFLSENVDTCVDEFLEEWARVSKMVVIARQVAQMSKEKMLPDVRLLSFDLQTVEFAYAEDYTVFITCEDQLFNGGTFDLRFSRTRPSPGSIEDYDSFNPHDDAEPYLRNILTPGHGRLAPSLHKLVRLLRDTLPIAVELEAIRRETERDQGQMPVDTFAKAAGWYRLMFGDLRHALDIRLMTDDRVAIFDASYSFYPSVSSSYRGPVKVEEKDASGDIVMSEPAVSDHTLKPIPNYPNIVLDCVRQALDSGSAVPGKIAPVDVALICDKNSVKPLIRAVYAQVAAKLKQAS |
| Length | 1145 |
| Position | Tail |
| Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.156 |
| Instability index | 46.13 |
| Isoelectric point | 6.59 |
| Molecular weight | 128683.85 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11400
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.78| 30| 54| 747| 776| 1
---------------------------------------------------------------------------
747- 776 (50.54/28.93) RGIPFT.HVNHTASTSVSPELAYIQSSLARS
802- 832 (48.23/27.32) RVIPLNwWSEKKAQVVTCVKLKYVQQPMGKS
---------------------------------------------------------------------------
|