| Description | Uncharacterized protein |
| Sequence | MSSQGNAYEVALFGEFFARDLKAILNRITLHSEYSESMHTREVTFEPIDAQHQRDIGNEPVVLRAKKELTRKDEGWILYSYLKPESVRAHPEATVRPWATCHVVGDALSFAQALGHTRRSQIYKRGYLFRRRTLVIQMFQQEQVDPNTQEPIPAHPDTLWEVEVKTANPIRNTQETPLSQSIDAVLEVQLLMKGLLDLRRQDV |
| Length | 203 |
| Position | Head |
| Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.508 |
| Instability index | 50.33 |
| Isoelectric point | 6.39 |
| Molecular weight | 23423.31 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP11398
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.40| 19| 23| 145| 163| 1
---------------------------------------------------------------------------
145- 163 (38.55/22.89) DP..NTQE.PIPAHPDTLWEVE
168- 189 (24.85/12.75) NPirNTQEtPLSQSIDAVLEVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.88| 16| 23| 59| 76| 2
---------------------------------------------------------------------------
59- 76 (23.31/19.71) EPVVLRAKKELTRKDegW
83- 98 (30.58/18.62) KPESVRAHPEATVRP..W
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) WILYSY 2) YLFRRR | 76 127 | 81 132 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab