Description | Uncharacterized protein |
Sequence | MSSQGNAYEVALFGEFFARDLKAILNRITLHSEYSESMHTREVTFEPIDAQHQRDIGNEPVVLRAKKELTRKDEGWILYSYLKPESVRAHPEATVRPWATCHVVGDALSFAQALGHTRRSQIYKRGYLFRRRTLVIQMFQQEQVDPNTQEPIPAHPDTLWEVEVKTANPIRNTQETPLSQSIDAVLEVQLLMKGLLDLRRQDV |
Length | 203 |
Position | Head |
Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.508 |
Instability index | 50.33 |
Isoelectric point | 6.39 |
Molecular weight | 23423.31 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP11398 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.40| 19| 23| 145| 163| 1 --------------------------------------------------------------------------- 145- 163 (38.55/22.89) DP..NTQE.PIPAHPDTLWEVE 168- 189 (24.85/12.75) NPirNTQEtPLSQSIDAVLEVQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.88| 16| 23| 59| 76| 2 --------------------------------------------------------------------------- 59- 76 (23.31/19.71) EPVVLRAKKELTRKDegW 83- 98 (30.58/18.62) KPESVRAHPEATVRP..W --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) WILYSY 2) YLFRRR | 76 127 | 81 132 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab