<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11398
| Description |
Uncharacterized protein |
| Sequence | MSSQGNAYEVALFGEFFARDLKAILNRITLHSEYSESMHTREVTFEPIDAQHQRDIGNEPVVLRAKKELTRKDEGWILYSYLKPESVRAHPEATVRPWATCHVVGDALSFAQALGHTRRSQIYKRGYLFRRRTLVIQMFQQEQVDPNTQEPIPAHPDTLWEVEVKTANPIRNTQETPLSQSIDAVLEVQLLMKGLLDLRRQDV |
| Length | 203 |
| Position | Head |
| Organism | Lentinula edodes (Shiitake mushroom) (Lentinus edodes) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Omphalotaceae> Lentinula.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.508 |
| Instability index | 50.33 |
| Isoelectric point | 6.39 |
| Molecular weight | 23423.31 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11398
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.40| 19| 23| 145| 163| 1
---------------------------------------------------------------------------
145- 163 (38.55/22.89) DP..NTQE.PIPAHPDTLWEVE
168- 189 (24.85/12.75) NPirNTQEtPLSQSIDAVLEVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.88| 16| 23| 59| 76| 2
---------------------------------------------------------------------------
59- 76 (23.31/19.71) EPVVLRAKKELTRKDegW
83- 98 (30.58/18.62) KPESVRAHPEATVRP..W
---------------------------------------------------------------------------
|