<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11395
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MEQGYTGGGGNWTIIPTMPTRTNSPAPSNQDHLYISSPPPPQQQQPFQNQQQQQQQQFQQQYNFQQQPQQQQQQHRVIQQQQQNHQHQSLASHFHLLNLVENLADAIENGTRDQQSDALVNELNTQFEKCQQLLNSISSSINAKAMTVEGQKRKLEEGEQLLNQRRDLISKYRNSVEELIKSEP |
| Length | 184 |
| Position | Middle |
| Organism | Cephalotus follicularis (Albany pitcher plant) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Oxalidales> Cephalotaceae> Cephalotus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.215 |
| Instability index | 67.97 |
| Isoelectric point | 5.83 |
| Molecular weight | 21254.03 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11395
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.38| 16| 27| 120| 135| 2
---------------------------------------------------------------------------
120- 135 (28.11/19.06) VNELNTQFEKCQQLLN
148- 163 (26.27/17.33) VEGQKRKLEEGEQLLN
---------------------------------------------------------------------------
|