Description | Uncharacterized protein |
Sequence | MVFLNGFWVIIVDTQYLDLQFCFGAMDLAYVFSKRRKAALNCGTVLMDLESKTFGQGPRELGGAVDLIKQFKLWPHHELFCKKSLPMLISESHYLDNVVGDREISKGEGMELDQLFHNNSYFNERNVQIRPFDMDILMEAFQMKETTPNNLPLADKRIPSAVTKSKSEPRIKEKMQKNHQYKDKDHRKKKQQQKDRSNGKEKYRSGHEDFSILHLKKQHNSIPASVMGRFQ |
Length | 231 |
Position | Head |
Organism | Cephalotus follicularis (Albany pitcher plant) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Oxalidales> Cephalotaceae> Cephalotus. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.696 |
Instability index | 31.11 |
Isoelectric point | 9.29 |
Molecular weight | 26940.70 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11375 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 106.78| 25| 25| 166| 190| 1 --------------------------------------------------------------------------- 142- 162 (25.50/15.60) ....QMKETTPNNLPLADKRIPSAV 166- 190 (42.10/30.53) KSEPRIKEKMQKNHQYKDKDHRKKK 194- 218 (39.18/27.90) KDRSNGKEKYRSGHEDFSILHLKKQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 100.36| 29| 38| 24| 52| 2 --------------------------------------------------------------------------- 24- 52 (50.24/25.39) GAMDLAYVFSKRRKAALNCGTVLMDL..ESK 63- 93 (50.12/25.32) GAVDLIKQFKLWPHHELFCKKSLPMLisESH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKYRS 2) IKEKMQKNHQYKDKDHRKKKQQQ | 201 171 | 205 193 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab