<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11372
| Description |
Med6 domain-containing protein |
| Sequence | MAAPTPSSEGNPPPVGTDMTGICFRDQLWLNTYPQDRNFIFDYFALSPFYDWSCNNQQLRLQSLHPLDMSHLMKMTGIEYVLSEIMEPNLFVIRKQKRDSPEKVTPMLCYYILDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKLEKIGYVDAENENVHSESKVGKELIDFKEVKRVDHILASLKRKLPPAPPPPPFPEGYIPALTSEAEKGPETQQAGEPQPPPIDPIIDQGPAKRMKF |
| Length | 244 |
| Position | Head |
| Organism | Cephalotus follicularis (Albany pitcher plant) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Oxalidales> Cephalotaceae> Cephalotus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.425 |
| Instability index | 60.07 |
| Isoelectric point | 5.86 |
| Molecular weight | 27534.32 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11372
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.23| 13| 30| 194| 208| 1
---------------------------------------------------------------------------
194- 208 (26.28/13.56) PAPPP..PPFPEGyiPA
225- 239 (24.95/ 7.92) PQPPPidPIIDQG..PA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.05| 9| 24| 103| 112| 2
---------------------------------------------------------------------------
103- 112 (13.78/14.05) KVTPMLcYYI
130- 138 (17.27/10.22) RVGRAL.YYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.66| 14| 30| 23| 36| 3
---------------------------------------------------------------------------
23- 36 (29.68/21.51) CFRDQLWLNT.YPQD
54- 68 (22.98/15.12) CNNQQLRLQSlHPLD
---------------------------------------------------------------------------
|