| Description | Mediator of RNA polymerase II transcription subunit 10 (Fragment) |
| Sequence | MDLSQNSSVGSGSNGTITTPTNDNTVDDPKQNLSQVINSIQKTLGLLHQLYLTVSSLNAASQLPLLQRLYNSLVMEFDNMVKLSEKCNIQVWVFSVMVDHLIYLIDDGKNDEFTRDVLNSCISKNQITRGKADAFNQPVTLQSLRKHLLEELEQTFPDEIESYREIRASSTAVSSQ |
| Length | 176 |
| Position | Middle |
| Organism | Cephalotus follicularis (Albany pitcher plant) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Oxalidales> Cephalotaceae> Cephalotus. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.323 |
| Instability index | 35.78 |
| Isoelectric point | 4.85 |
| Molecular weight | 19709.93 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP11370
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.75| 13| 19| 105| 117| 2
---------------------------------------------------------------------------
105- 117 (23.94/17.61) IDDGKNDEFTRDV
127- 139 (23.82/17.49) ITRGKADAFNQPV
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MDLSQNS 2) SYREIRA | 1 162 | 7 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab