<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11366

Description Pkinase domain-containing protein/Usp domain-containing protein/U-box domain-containing protein
SequenceMSRNSAAEETMTSVAVAVNGVVGSGSGNGSKRAVRWAVDNLLPKADRFILVHVIPTITSVPTPSGDHMPIAELDENVVKMYVEEVKLKFAEIFLPFKKLCKTQKMEILVLEDESPATALIRYISESRIRSFVMGSCSINCIIRKMTGPGVPKTVLRCAPDTCDIHIVSRHRIISKSANPPSSYGTSSGHWMFAQRDYEKGSCGTNKPLKHKYDQSIGASSISELSDPHSHVSTHTGISTNAIADRVNCQNFGDNFDTITIKRCNSMASTKIEESDVMAEMEQLRLELQNTVAMYKRTCEELVHAQNKVQLLSSECLEEARRVNNAHEREEYLRKIAAEERAKYLQSMKEIEEAKSMLANEVYEKQIAELNALKEFIEKQKIANALLLNDRRYIRYTSDEIAVATDFFSESNVIGEGGYGKVYKCSLHHTPVAVKVLQPDALEKKQEFLKEVEVLSQLRHPHIISLLGACPESGCLVYEYLENGSLEDYIFHRNGKPPLPWFVRFRIVFEVACGLAFLHNSKPEPIVHRDLKPANILLDRNYISKIGDVGLAKFITDVVPDNISEYRNSILVGTLYYMDPEYQRTGTVRPKSDLYAFGLITLQLLTARRPHGLLHVIENAIKNGSLSDILDESISDWPARETEELARIALKCSKLKCRERPDLETEVMPVLERLVYVTVAKAKVERNNIYPPSHYFCPILQEIMDDPYIAADGFTYEHRAIKAWLDKHKLSPVTKTKLQDSLLIPNHTLRSAIQEWKSLAMFSST
Length764
PositionTail
OrganismCephalotus follicularis (Albany pitcher plant)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Oxalidales> Cephalotaceae> Cephalotus.
Aromaticity0.07
Grand average of hydropathy-0.283
Instability index49.53
Isoelectric point6.68
Molecular weight86208.00
Publications









Function






Annotated function

Functions as an E3 ubiquitin ligase.



GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11366
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.22|      27|     177|     349|     376|       1
---------------------------------------------------------------------------
  329-  359 (32.85/22.60)	EEYLRKIAAEERAKYLQsmkEIEEAkSMLAN
  360-  389 (36.37/20.77)	EVYEKQIAELNALKEFIekqKIANA.LLLND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.96|      34|      34|     489|     522|       2
---------------------------------------------------------------------------
  489-  522 (65.23/50.18)	IFHRNGKPPLPWFVRFRIVFEVACGLA.FLHNSKP
  525-  559 (52.73/39.04)	IVHRDLKPANILLDRNYISKIGDVGLAkFITDVVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.94|      13|      16|     288|     300|       5
---------------------------------------------------------------------------
  288-  300 (23.90/17.60)	QNTVAMYKRTCEE
  305-  317 (22.04/15.65)	QNKVQLLSSECLE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11366 with Med32 domain of Kingdom Viridiplantae
Unable to open file!