<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11361
| Description |
Uncharacterized protein |
| Sequence | MDSEGKKFGRGQRELTGAVDLISHYKLVPHHEFFCKRALPLSIADTHYLHNVVGDTEIRKGEGMQLFQLIQNTSHSRDNDARIQPFDLDVLREAFQLRESAPVDLPPAEKGVPTIPGKLKIESKEKERKHKKHKDRDKDKDKDHKKHKHRHKDRSKDKDKDKEKEKEKEKKKDKTVHHESGGDHSKKHHEKKRKHDGDEDLNDVHKHKKSKHKSSKIDELGAIKVAG |
| Length | 227 |
| Position | Head |
| Organism | Cephalotus follicularis (Albany pitcher plant) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Oxalidales> Cephalotaceae> Cephalotus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.511 |
| Instability index | 37.11 |
| Isoelectric point | 9.51 |
| Molecular weight | 26359.46 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11361
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.28| 19| 19| 125| 143| 1
---------------------------------------------------------------------------
125- 143 (36.32/12.19) EKERKH.KKH..KDRDKDKDKD
179- 200 (24.96/ 6.24) ESGGDHsKKHheKKRKHDGDED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.18| 15| 60| 144| 158| 2
---------------------------------------------------------------------------
144- 158 (27.71/11.57) HKKHKHRHKDRSKDK
160- 174 (23.19/ 8.33) KDKEKEKEKEKKKDK
205- 219 (25.28/ 9.83) HKHKKSKHKSSKIDE
---------------------------------------------------------------------------
|