<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11356
Description |
Uncharacterized protein |
Sequence | MNDLPFRQGMEDDKSSKSTQELAMEGRKYLEETIEAAFAILSSMNDELCNPTLWTTSTNSSSSNGVVVFGNGDAAAAASSDASASGHHHMDHMGAGVGIGSGNSGLDEARLRYKNSVAALRAVLKAIPISLKAKAFETGSTLRGSGSPADQADIEKLEEQAITLREELANNNTHLKLLINQLRDFITDISTWQSPCSV |
Length | 198 |
Position | Head |
Organism | Cephalotus follicularis (Albany pitcher plant) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Oxalidales> Cephalotaceae> Cephalotus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.347 |
Instability index | 32.81 |
Isoelectric point | 4.98 |
Molecular weight | 21116.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11356
No repeats found
|