<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11339

Description Heat shock protein 70 (Hsp 70) family protein
SequenceMCSLFLDLNVFVYNVVLQFHDLKGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRIMEYFIKLIKKKHQKDISKDNKALGKLRRECERAKRALSSQHQVRVEIESLFDGVDLSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLQKSQIDEIVLVGGSTRIPKVQQLLKDFFEGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQRSGGAPGAGGESSTEEEDESHDEL
Length673
PositionUnknown
OrganismArabidopsis thaliana (Mouse-ear cress)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
Aromaticity0.06
Grand average of hydropathy-0.470
Instability index30.27
Isoelectric point5.08
Molecular weight74374.31
Publications
PubMed=11130714
PubMed=17272265
PubMed=27862469

Function

Annotated function 
GO - Cellular Component
endoplasmic reticulum	GO:0005783	IEA:UniProtKB-KW

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11339
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      91.78|      25|      27|     584|     609|       1
---------------------------------------------------------------------------
  555-  574 (24.25/14.35)	.....VKEAEEFAEE.DKKVKEK.IDA
  584-  609 (38.16/33.48)	NMKNQVSDKDKLADKlEGDEKEK.IEA
  618-  638 (29.36/19.28)	LDENQNSEKE......EYDEKLKeVEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.93|      29|     244|     400|     428|       2
---------------------------------------------------------------------------
  400-  428 (50.89/29.50)	NPDEA.VAYGAAVQGGILSGEGGDETKDIL
  429-  450 (23.71/10.10)	LLDVApLTLGIETVGGVM.......TKLI.
  653-  673 (29.33/14.11)	.........GAPGAGGESSTEEEDESHDEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.25|      14|      21|      42|      61|       3
---------------------------------------------------------------------------
   42-   55 (26.89/26.97)	VIGIDLGT..TYSCVG
   64-   79 (23.36/ 7.80)	IIANDQGNriTPSWVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.93|      18|      26|      82|     107|       4
---------------------------------------------------------------------------
   85-  103 (26.39/32.09)	RLIG......EAAKNQAAVnPERTV
  108-  131 (25.53/ 6.22)	RLIGrkfedkEVQKDRKLV.PYQIV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.95|      17|     136|     221|     240|       5
---------------------------------------------------------------------------
  221-  240 (25.46/23.71)	GLDKKGGEKNILVfdlGGGT
  361-  377 (29.49/17.70)	GLQKSQIDEIVLV...GGST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.57|      13|      27|     503|     515|       6
---------------------------------------------------------------------------
  503-  515 (23.01/15.59)	APRGTPQIEVTFE
  530-  542 (20.56/13.16)	ASGKSEKITITNE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11339 with Med37 domain of Kingdom Viridiplantae
Unable to open file!