<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11333
| Description |
Cyclin family protein |
| Sequence | MKLAQHIKVRQRVVATAITYMRRVYIRKSMVEFEPRLVALTCLYLASKAEESIVQARNLVFYIKRLYPDEYNKYELKDILGMEMKVLEALDYYLVVFHPYRSLSEFLQDAALNDVNMNQITWGIVNDTYKMDLILVHPPYRIALACIYIASVHREKDITAWFEDLHEDMNLVKNIAMEILDFYENYRTITEEKVNSAFSKLALKL |
| Length | 205 |
| Position | Kinase |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.033 |
| Instability index | 37.51 |
| Isoelectric point | 6.53 |
| Molecular weight | 24248.08 |
| Publications | PubMed=11130714
PubMed=27862469
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11333
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.58| 11| 37| 91| 101| 1
---------------------------------------------------------------------------
91- 101 (24.22/15.94) DYY...LVVFH.PYR
127- 141 (13.37/ 6.03) DTYkmdLILVHpPYR
---------------------------------------------------------------------------
|