<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11318
Description |
ATP-dependent DNA helicase |
Sequence | MESEAIQEDLQNLDVELKDVQGQISALIEHQDRLYERKSELKTLLKALAASGSPVASSGGSSAIENWSETFEWDSRADDVRFNVFGISKYRANQKEIINAIMTGRDVLVIMAAGGGKSLCYQLPAMLRGGTTLVVSPLLSLIQDQVMGLAALGISAYMLTSTSGKENEKFVYKALEKGEDDLKILYVTPEKVSKSKRFMSKLEKCHNAGRLSLISIDEAHCCSQWGHDFRPDYKNLSILKTQFPKVPMVALTATATQKVQNDLIEMLHIPKCVKFVSSVNRPNLFYSVREKSAVGKLVVDEIAEFIRESYSNNESGIVYCFSRKECEQIAGDLRERGISADYYHADMDANMREKVHMRWSKNKLQVIVGTVAFGMGINKPDVRFVIHHSLSKSMETYYQESGRAGRDGLPSECILFFRSADVPRQSSMVFYEYSGLQNLYDIVRYCQSKTKCRRSAFFRHFGEPSQDCNGMCDNCALSSEVKEVDVSDLSKLVVSMVQETQAKDQRVTMLQLGDKLRNKHKDLKRRISAHTIFDKRLCNNGTIGQPIVARKKDNQNGNL |
Length | 559 |
Position | Unknown |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.367 |
Instability index | 39.51 |
Isoelectric point | 8.58 |
Molecular weight | 62901.31 |
Publications | PubMed=11130712
PubMed=27862469
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW
DNA helicase activity GO:0003678 IEA:UniProtKB-EC
hydrolase activity GO:0016787 IEA:UniProtKB-KW
nucleic acid binding GO:0003676 IEA:InterPro
|
GO - Biological Process | DNA recombination GO:0006310 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11318
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.71| 10| 40| 416| 425| 2
---------------------------------------------------------------------------
416- 425 (19.53/12.40) FFRSADVPRQ
457- 466 (21.18/14.04) FFRHFGEPSQ
---------------------------------------------------------------------------
|