| Description | Surfeit locus protein 5 subunit 22 of Mediator complex |
| Sequence | MLLFLLGGSSSHSHQLLLLSSFLCKRPAIIMNKGGGSGGGSGGGSGPTAAAAAAALQKQKALLQRVETDITSVVDNFTQIVNVSRVSDPPVKNSQETYMMEMRASRMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRIEEFDQEAEKTNRLLARIADDASANLKELESHYYSSAQRLTLDI |
| Length | 184 |
| Position | Head |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.152 |
| Instability index | 44.61 |
| Isoelectric point | 6.08 |
| Molecular weight | 19828.27 |
| Publications | PubMed=11130712 PubMed=27862469 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP11315 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AAAAAL 2) QLLLLSSFLCKRPAIIMNKG | 51 15 | 56 34 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab