<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11304
Description |
Similar to S.cerevisiae protein SSN8 (Cyclin-like component of the RNA polymerase II holoenzyme) |
Sequence | MAANYWESSQCKRWLLRHADVEAAREEDRRYVDPLELEGITVWCINIISMLGQRLQTRQRVIATGTVYFQRFYSKNSYASTDPILVLVTCMYLASKVEEAPVRIRVLCAEASRMMQELGYHELPNHIPTIAEMEFYLLEELDFDLLVFHPYDTLMTLCDACVGYVKMDTNHRDEMQAALRQASWSIVNDMYRSSLPLEQPPYVLAVAALYLALVVVLPMAQEVQALVRDMAPGGVTLLDFLAGMNVSLPIVADTVQDMLSRYDLWRQLTHTPHGGLDMLHDHAAMFQRLYHMRKAYCQTLVTRSEIEDTTDRDLRTY |
Length | 317 |
Position | Kinase |
Organism | Malassezia sympodialis (strain ATCC 42132) (Atopic eczema-associated yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.054 |
Instability index | 46.78 |
Isoelectric point | 5.20 |
Molecular weight | 36541.78 |
Publications | PubMed=28100699
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11304
No repeats found
|