<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11301
| Description |
Uncharacterized protein |
| Sequence | MHLEHQQRVAELAKAQPGVTLPPPAHYRYTFPTLSPPGALEQLLAQLRARWVSVRQTGASAASSGAPGGGSQKSQGSGQQLSVEGHVYAIGTDWLVRAGNVLLAGGAVKGMFLEAEYLPLPTMSTRSGEHGSTDLPFLLSNLLLSVLPNVPDARIVAVTIGDAQWEEMLWDEPDEDEPQKPAKKDEDDIYAEDDDQPATRKGDWVGVERDRRSAYLIIGALKQEGLV |
| Length | 227 |
| Position | Head |
| Organism | Trametes pubescens (White-rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Trametes.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.371 |
| Instability index | 51.26 |
| Isoelectric point | 4.87 |
| Molecular weight | 24544.26 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11301
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.43| 15| 19| 176| 194| 1
---------------------------------------------------------------------------
180- 194 (26.34/21.90) KPAKKDEDDIYAEDD
196- 210 (28.10/12.04) QPATRKGDWVGVERD
---------------------------------------------------------------------------
|