Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHAREIVFEPFDAQHQRDSGTEPVLLRARKELLEPDAKWLLYSYLKPESVRVHPEATVRPWATCQVVGEALELASVLGYVRRSQIYKKGYVFRRGNLVIQMFQQEHVDPKTGKAIPAHVDTLWEVEVKTAAPVRNTQETPLSQSLDAVLAVQLLMKGLLDLRRQDV |
Length | 166 |
Position | Head |
Organism | Trametes pubescens (White-rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Polyporaceae> Trametes. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.298 |
Instability index | 45.66 |
Isoelectric point | 7.89 |
Molecular weight | 18967.65 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11299 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.64| 21| 22| 2| 23| 1 --------------------------------------------------------------------------- 2- 23 (34.60/30.14) HAREIVFEPfDAQHQRDSGTEP 27- 47 (38.05/27.23) RARKELLEP.DAKWLLYSYLKP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KGYVFR 2) MHAREI | 88 1 | 93 6 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab