Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSEILLEPLARLQTLSHTLFQSLGPPQSRPPPPPSVGDLLLVDAQLAAAVQLARAHQVKQRRIEQLKEEVLELDRRWRDTVRALDEGRRELDAIVREGEERIKAIEEAKAAAIPYPELLAYAQSLSAFTSAPPNMPDLAPGQPPPPLFFPPFPNEEKMRRGHMSDEAPLGILGETHSVGKPPTVSPQVELPAHIAANPYRPDFRPPQQQPFFDLDLDLNPDL |
Length | 222 |
Position | Middle |
Organism | Trametes pubescens (White-rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Polyporaceae> Trametes. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.468 |
Instability index | 78.79 |
Isoelectric point | 5.10 |
Molecular weight | 24703.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11295 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 132.89| 28| 110| 7| 34| 1 --------------------------------------------------------------------------- 7- 34 (54.96/24.23) EPLARLQTLSHTLFQSLGP..PQSRP..PPPP 117- 146 (38.15/14.67) ELLAYAQSLSA..FTSAPPnmPDLAPgqPPPP 156- 182 (39.79/15.60) EKMRRGHMSDEAPLGILGE..THSVG..KPP. --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QPFFDLDLDLNPDL 2) YRPDFR | 209 199 | 222 204 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab