<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11292
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDVDLHPPDDYSHRFFIWHEWILAHGPLTAENAFDYFTTSMFYDKQSNNQVLRMQTMHTGLPLVNEAEELRRFTGIEFALVHAEPPSLFIIHKRERLSPHEVRPLAVYFILNHRIYQSPDVYTLISNRLLTSLHSLQKSLDTLRSHRPTYTPRTGFVWPIVEPPATDAAGSKKRAAAEGEPVPAAEVPEDLSSERGLPAGPADAKRQQNNMLLFNAMRTTAFHAHESFQLPAAPSEESVPETPATATAGRSSMTPAPVPRGTTPKGPSNAPTPQEPPARGPPGGGKKKKKRTLTLPTPAS |
Length | 300 |
Position | Head |
Organism | Trametes pubescens (White-rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Trametes.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.552 |
Instability index | 62.21 |
Isoelectric point | 8.03 |
Molecular weight | 33227.21 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11292
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.22| 29| 31| 216| 244| 1
---------------------------------------------------------------------------
216- 244 (52.79/20.91) AMRTTAFHAH.ESFQLPAAPSEESVP.ETPA
248- 278 (45.44/17.14) AGRSSMTPAPvPRGTTPKGPSNAPTPqEPPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.06| 16| 17| 89| 105| 3
---------------------------------------------------------------------------
89- 105 (24.87/23.04) FIIHKRERLSPhEVRPL
109- 124 (30.20/21.55) FILNHRIYQSP.DVYTL
---------------------------------------------------------------------------
|