<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11278
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELLLFASVPAHQHHELLQQLAGLTAMQPHHRLERRLVFKAYRKPGLVTTRVGASQDVQGADLQRLNKMLNGGMYYTQVVGPVTKADFGATSSSAMSASHDADVSMSGTDQSSYCYENQPWKLEFRDIPEAGTRSAVTTRLMASASLPKGDIAVPMNAWGYSFVTEYMVEGDVFVQNDIVIFLHRVLLYPQAESQDLHGPRRQLPAYHELTPLERTGSYVLQAAITVQDGSNQEMMKTASQHLFGLREQLKSAVRLEQADRLSLDTRAK |
| Length | 270 |
| Position | Head |
| Organism | Aspergillus aculeatus ATCC 16872 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.339 |
| Instability index | 39.55 |
| Isoelectric point | 6.59 |
| Molecular weight | 30101.82 |
| Publications | PubMed=28196534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11278
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 112.45| 34| 88| 29| 64| 1
---------------------------------------------------------------------------
29- 64 (51.51/39.16) QPhHRLERRLVFKAYRKPGlVTTRVGASQDVQGADL
120- 153 (60.94/36.78) QP.WKLEFRDIPEAGTRSA.VTTRLMASASLPKGDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.80| 22| 45| 195| 216| 3
---------------------------------------------------------------------------
195- 216 (41.29/28.54) SQDLHGPRRQLPAYHELTPLER
241- 262 (37.51/25.32) SQHLFGLREQLKSAVRLEQADR
---------------------------------------------------------------------------
|