<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11273
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSASFRVGPPSPASPAPESLKETPQHPTISSDQIPQTPTSPPLMSVSAHNYATHFVPSQTSPSQATSQPTSLSSPPSSAPMSTQPSQQPVVGGSANSFPTPASSVSGHIPGTTSFDEPDAPAKSMGSGPSEGGVVPAGGAFATAQRAEHRRTDHDRQPGGDSEGAVRDYAATGLPVHGDAMDIDREVPGSSDGSMSLESLQHDFSSAFHLCKSSYTATGPDPSLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPGAPGGLIQMTMWPEEEWQNQKVFGKEIKVADMDSALHALQLKAMKMEPGAVPNSEQWEDVLGHEKPSKHAGGGGDTGKKAVAPPNGARMQANGTPGPGVSDAERSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSASDGMGKKKRKKVGPSDDDGALGF |
| Length | 444 |
| Position | Head |
| Organism | Aspergillus aculeatus ATCC 16872 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.738 |
| Instability index | 54.74 |
| Isoelectric point | 5.88 |
| Molecular weight | 46346.51 |
| Publications | PubMed=28196534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11273
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 101.46| 20| 20| 62| 81| 1
---------------------------------------------------------------------------
23- 47 (25.12/ 8.47) ESLKETP.qhptiSSDQIPQT.......PTSPP
49- 74 (28.82/10.92) MSVSAHNyathfvPSQTSPSQ.......ATSQP
75- 104 (24.08/ 7.79) TSLSSPP...ssaPMSTQPSQqpvvggsANSFP
105- 127 (23.43/ 7.35) TPASSVS...ghiPGTTSFDE.......PDAPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.47| 15| 68| 273| 287| 2
---------------------------------------------------------------------------
273- 287 (30.60/16.15) GRNKPVKHEPGAPGG
344- 356 (26.29/12.69) GHEKPSKHAGG..GG
365- 378 (21.57/ 8.90) PPNGARMQANGTPG.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.45| 24| 68| 169| 200| 3
---------------------------------------------------------------------------
144- 167 (44.69/21.25) GAF....ATAQRAEHRRTDHDRQPGGDS
169- 196 (37.76/36.20) GAVrdyaATGLPVHGDAMDIDREVPGSS
---------------------------------------------------------------------------
|