<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11269
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPATVPPPTQAQTAPAAPALAKIPKNSSAPPVPASAPLAAQQQSNQTQQQTPAEIPQPAQPGAAGAEDTTTGTAQDPALPPAPDSPRTFAARQRELARDLVLKEQQIEYLISVLPGIGSSEAEQEHRIRELEGELRRWEGVRGERMLQLKALRGRLEGVLGAMEVGIYGEREV |
| Length | 205 |
| Position | Middle |
| Organism | Aspergillus aculeatus ATCC 16872 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.479 |
| Instability index | 62.07 |
| Isoelectric point | 4.92 |
| Molecular weight | 22037.50 |
| Publications | PubMed=28196534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11269
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.52| 14| 16| 35| 50| 1
---------------------------------------------------------------------------
35- 48 (25.72/ 6.02) ATVPPPTQAQTAPA
53- 66 (22.80/ 6.80) AKIPKNSSAPPVPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.78| 22| 23| 156| 177| 2
---------------------------------------------------------------------------
124- 137 (16.74/ 6.75) ...RQR.ELARDL......VLKEQ
156- 177 (41.57/25.23) QEHRIR.ELEGELRRWE.GVRGER
180- 203 (28.48/15.49) QLKALRgRLEGVLGAMEvGIYGER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.63| 17| 26| 72| 96| 3
---------------------------------------------------------------------------
72- 95 (24.88/20.46) AQQQSNQTQQqtpaeipQPAQPGA
98- 114 (30.75/ 8.79) AEDTTTGTAQ.......DPALPPA
---------------------------------------------------------------------------
|