Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MAESKELDKQDQIFTSADRIRQLNDVDQDVTNLIHSAGLAVQALTNAKSDDHSSATATTDTSFDSHKSRFKEATSQYFALLSSIDVRLRRQVYALEEASVLAPDSASRTGEGGAAGGGGAGAANPLDISWLNSRKDTVGKDKEAELWAAARGFAEQIGNPTSTEPAKAEGGHKMEVD |
Length | 177 |
Position | Head |
Organism | Aspergillus glaucus CBS 516.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Aspergillus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.587 |
Instability index | 35.07 |
Isoelectric point | 4.91 |
Molecular weight | 18810.29 |
Publications | PubMed=28196534 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11259 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KDKEAELWAAARGFAEQIG 2) LDISWLNSRK | 140 126 | 158 135 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab