<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11250
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPATQPQVPDAAPALAKVTKNSTAHPVPANVASQSQGQASPPPPGQPGGGSAAPETPGGKGDGGAGVVGGGDLSDPLAPAPDPPSTFASRQRELARDLIIKEQQIEYLISVLPGIGSSEKEQEVRLRELEGELRTVEEERERKVRELRGLRRKLEGVLGGVEMGIYGER |
| Length | 201 |
| Position | Middle |
| Organism | Aspergillus glaucus CBS 516.65 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Aspergillus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.531 |
| Instability index | 60.43 |
| Isoelectric point | 4.97 |
| Molecular weight | 21259.52 |
| Publications | PubMed=28196534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11250
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 53.32| 15| 16| 151| 166| 1
---------------------------------------------------------------------------
132- 148 (16.83/ 7.85) IKEQQIEylISVLPG.IG
151- 166 (20.57/15.71) EKEQEVR..LRELEGeLR
169- 181 (15.92/ 6.77) EEERERK..VRELRG...
---------------------------------------------------------------------------
|