<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11249
Description |
Uncharacterized protein |
Sequence | MFNRNFPPFNSFGGFYPRGNDSPSNVLRVALISNKSIDTRRPAGTGYTSKVRVRDKYHIVGFISSGTYGRVYKALAKDGRRGEFAIKKFKPEKEGEAIQYTGLSQSAIREMSLCSELDHPNVVQLAEIILEDKCIFMVFEYTDHDLLQIIHHHTTPQRHAISAPMVRSILFQLLNGLYYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMRIIEIMGMPRKETWPGIVSMPEYSQLQSLALSRASSGHHFSRPPSLESWYTNCLKNGGYSSTSSIGTPGAEGLDLLSRLLEYDPTKRITAQEALEHPYFKEGGHVSADCFQGLEGRYPHRRVTQDDGDIRSGSLPGTKRSGLPDDSLLGRAAKRLKE |
Length | 446 |
Position | Kinase |
Organism | Aspergillus glaucus CBS 516.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Aspergillus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.348 |
Instability index | 43.69 |
Isoelectric point | 9.34 |
Molecular weight | 50139.84 |
Publications | PubMed=28196534
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11249
No repeats found
|