Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEPQPPEQPQQQPPPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISRSSDDTANEDTDTSADPDAQAFAAYLAYLYSYWKTPDYAQFLTHPGPTLRALRLLQEETFRRDVIRPQVIEGLAGLGLVGEQQQQEGAQEGGEEQGQEGAEKQDGV |
Length | 158 |
Position | Middle |
Organism | Aspergillus glaucus CBS 516.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Aspergillus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.691 |
Instability index | 57.53 |
Isoelectric point | 4.24 |
Molecular weight | 17523.99 |
Publications | PubMed=28196534 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11248 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 213.00| 66| 81| 4| 72| 1 --------------------------------------------------------------------------- 4- 72 (105.59/64.19) QPPEQPQ..QQPPPTLTNPRFTLELEFVSSLANPYYLSHLAVTypNLLGiSRSSDDTANEDTDTSADPDAQ 86- 153 (107.42/55.93) KTPDYAQflTHPGPTLRALRLLQEETFRRDVIRPQVIEGLAGL..GLVG.EQQQQEGAQEGGEEQGQEGAE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEQGQEGAEKQDGV 2) PDAQAFAAYLAYLYSY | 145 69 | 158 84 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab