<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11226
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRTPSAPLRTGPPSPSSPAPFTSFKDSLQPPITPDQIPQTPTSPPLMSVSAPNNASDFASMQALPNQATSQPASLSSPPSSAPMSTQTSQQPTTGITNSFPTPASSVDPDHSDKSFGTGISETGAPAPASASAAPTQKSEYRRTDHDRNLETPQTGTGVRDFAQMGGSSQVLHGDAMELDTEPSAHTKSNWPSLESLQKEFSSAFHLCKSSHIATGPDPSVDLISLYGLGPVARSVARNDPVTGEKINRLRKSYEGKLKGLGLSGRNKAVKHDPSSSGGLRQMMMWPEEEWQNQKVFGKEIKVADMDSALHNLQMKAMKMEPGPVPNNDYWEDVLGHDKPTKNTNTGEAAKKPAAPQSSVRTAAQPNGTPISAEPERSRPSRGRKRNYDDNSFVGYGEGYADDDDESGFYSNSEGGGKKKRKKDHVSKIPAPPDRGGSYGVGMFGIGAR |
| Length | 451 |
| Position | Head |
| Organism | Aspergillus sydowii CBS 593.65 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.865 |
| Instability index | 50.75 |
| Isoelectric point | 6.81 |
| Molecular weight | 48059.49 |
| Publications | PubMed=28196534
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP11226
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 146.97| 29| 31| 3| 31| 1
---------------------------------------------------------------------------
3- 25 (36.90/11.87) ...........DRTPSAPLRTGPP..SPSSPAPFTS
26- 59 (36.52/11.67) FKDSLQppitpDQIPQTP..TSPPlmSVSAPNNASD
60- 88 (38.79/12.81) FA.SMQ..alpNQATSQPASLSSP...PSS.APMST
89- 113 (34.76/10.79) .QTSQQ........PTTGITNSFP..TPASSVDPDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.96| 19| 37| 282| 302| 2
---------------------------------------------------------------------------
282- 302 (33.60/35.40) LRQMMMWP.....EEEWQNqkVFGKE
317- 340 (31.36/24.55) MKAMKMEPgpvpnNDYWED..VLGHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.53| 16| 31| 228| 243| 3
---------------------------------------------------------------------------
228- 243 (30.07/16.31) LYGLGPVARSVA.RNDP
260- 276 (25.47/12.83) LKGLGLSGRNKAvKHDP
---------------------------------------------------------------------------
|