<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11219
Description |
Uncharacterized protein |
Sequence | MDSQPTAKALHNRINANVSQLLQRFENIMATATVDNSSHASTAVETYQLDVESTALIRAAEDILALTRMMKETWLFGKLDTLGEDERDIKRREKLEDNVLAVQKAIEERGLLKPAE |
Length | 116 |
Position | Head |
Organism | Penicilliopsis zonata CBS 506.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicilliopsis.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.449 |
Instability index | 43.46 |
Isoelectric point | 5.09 |
Molecular weight | 13053.64 |
Publications | PubMed=28196534
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11219
No repeats found
No repeats found
|