<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11210

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDFPGGATTNIRVIDGFSTIYWRIYTEELTIASHAPEVPANGLTILKHLSRLKDLELRLRNLDCLVACLPRRLGLWVFSATPDFESLSSLYLAGNQDGSNRLHVDSSTLRVSASGNATSHDLMRNLSAEPQPPSTNNGAPQKPQAAQAPARRIDSYSGSAAIYATFVSAVTGAISLQLVRRHGAIPLGSRTLFTAVEQNGYESPQIANDDPASVPSLTTLQIQLTPIGKVIVSFQSVGQMGITRLLNVDSKATDLLNAPIGLDLWLSPNGTVARLTAVGVDRANIPSPTLSSMQGAGKDSSFITPMAKRNLWKSNVLGWLGNFGLALGSLEEELWVEVEVFDSFYARLAGESTSALPLKRFLWPARYCFRRTASDLSPSSYGASDGFSLLDDPLDFAQRWFSSVPNSIQEVIASDPSIHSEEHSQSKNQALTSPKAELSDGVESLSRTAEYPDLSTATLVYPTPPDGALSVGVNVPHGPETLHEEPTLNPPHLLNRPQGLGDPHGYPDDSAIQGLNPSSNLAIGSGLYDGDDDEDLFGEMNDKNFGSKGISDADFSFFDNPGFDDMGEDVTQSEDMLEPPKADFELEDAMPDPPSEVDSIHEMEVQSSPACPTPTAQPEPLEEASEPSPEEDRQHHDETRQTISPPLSPVEVKKILFAGEEQIGNHSTGRKQSHYDPVLFRQNLQDWNEKYGVEGKFMSAVGTAFPSEAAHTTKDIPTIGLPPRSKSLASTKDSLKIQGPSPTIARPPVRSDSVSSAGTSDSSEEVPSEAEISPVTLATLKRKRAHSDSGESAASSFGKSSVMPDQDPAMQKAGDSIFLGNFLSLLLDWSLMGYFSVSNSQISPALLRKEDQIHVAQILVDQITQSSLNHALDGRISLSDLENDSFSLRTVFEEPIFGGEIERLDLKSYVSLQESSTAPNTTTDPNTARQSTPNIQRKEPGKVAISKLPLPHLRLRRGQDFMEILPPGVAFWETFGLEPAYGPKDVSAYCIHPHIAPEAADAFLERLGLLYSRCGLGKHVRGDRCKKFEQGLGSWNVNMSGDSDYSSVMHLLMALCEELGTAFLQSPQTKENLVIYIINPFSHAVALTDICWAFWHLLQKYVSEASRQNIRQLDEIMLQVIPMDFIASSESLVVPTQSEYLSLALEVYSRCPLKDSRLSLVNATPPILLAENSPKTINFRLAAEATSPLQEAKSLHLAYSRSLDRRWITVAWSDSTGSFQRTMSYCLRFRGSTAARSLSEVRGEIWGATKTIMEKTQARWRLLIANTDPVEQEEIDVWVNLIDQYNQHRSLPLELVILNVNPVPDLHLEPPSLPLYTNILHPHTSSTPVTTPLPLPNALSPDPLGNAATTPTNSGNNPVNAATPTDGLPEPESESLLTDICDESWALILSHRLNYSPHLTEYRPALASGHLLRRKGPADNEGVFAANVNLVYTQRPYTSYDLLLREIIGMYRDLTTLARARGTRSAQRSTLPWHVATAVRAQELLSYVL
Length1489
PositionKinase
OrganismPenicilliopsis zonata CBS 506.65
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicilliopsis.
Aromaticity0.07
Grand average of hydropathy-0.316
Instability index56.79
Isoelectric point5.03
Molecular weight162892.85
Publications
PubMed=28196534

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11210
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.84|      18|      24|     476|     499|       1
---------------------------------------------------------------------------
  476-  499 (32.79/26.88)	PHGPetlheeP......TLNPPHLLNRPQG
  503-  526 (30.05/13.24)	PHGY......PddsaiqGLNPSSNLAIGSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.10|      18|      25|     717|     741|       2
---------------------------------------------------------------------------
  713-  730 (34.00/12.33)	TKD.......IPTIGLPP.RSKSLAS
  731-  756 (22.10/16.36)	TKDslkiqgpSPTIARPPvRSDSVSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.24|      18|      25|    1290|    1314|       3
---------------------------------------------------------------------------
 1290- 1314 (19.85/28.36)	SLPLELVIlnvnPVPDlHLEPPslP
 1326- 1343 (34.40/18.81)	STPVTTPL....PLPN.ALSPD..P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.10|      24|      25|     529|     552|       4
---------------------------------------------------------------------------
  529-  552 (40.54/26.47)	DGD.DDEDLFGEMNDKNFGSKGISD
  554-  578 (36.57/23.06)	DFSfFDNPGFDDMGEDVTQSEDMLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.58|      32|      33|     580|     612|       5
---------------------------------------------------------------------------
  580-  612 (55.52/30.47)	PKADFE.LEDAmPDPPSEVDSIHEMEVQSSPACP
  614-  646 (55.06/26.21)	PTAQPEpLEEA.SEPSPEEDRQHHDETRQTISPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.51|      29|      33|     795|     823|       6
---------------------------------------------------------------------------
  795-  823 (52.17/28.35)	SSFGKSSVMPDQ.DPAMQKAGDSIFLGNFL
  830-  859 (45.34/23.75)	SLMGYFSVSNSQiSPALLRKEDQIHVAQIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      82.90|      19|      24|     990|    1008|       7
---------------------------------------------------------------------------
  964-  976 (18.69/ 7.43)	......ILPPGV.AFWETFG
  990- 1008 (34.92/20.28)	C.IHPHIAPEAADAFLERLG
 1014- 1033 (29.29/15.82)	CgLGKHVRGDRCKKFEQGLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.72|      11|      33|     432|     442|       8
---------------------------------------------------------------------------
  432-  442 (19.78/ 9.09)	TSPKAELSDGV
  463-  473 (20.94/10.05)	TPPDGALSVGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.75|      20|      27|    1184|    1206|       9
---------------------------------------------------------------------------
 1184- 1203 (33.31/30.67)	EATSPLQEAKSLHLAY.....SRSL
 1214- 1238 (30.45/16.47)	DSTGSFQRTMSYCLRFrgstaARSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.32|      15|      50|     296|     312|      10
---------------------------------------------------------------------------
  296-  312 (21.58/23.24)	AGKDSSFItPMaKRNLW
  349-  363 (28.74/18.71)	AGESTSAL.PL.KRFLW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.05|      16|      31|     649|     664|      14
---------------------------------------------------------------------------
  649-  664 (26.60/18.09)	PVEVKKILFAGEEQIG
  677-  692 (30.45/21.81)	PVLFRQNLQDWNEKYG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.68|      18|     139|       4|      21|      15
---------------------------------------------------------------------------
    4-   21 (33.65/19.46)	PGGATTNIRVIDGFS...TIY
  143-  163 (28.03/15.05)	PQAAQAPARRIDSYSgsaAIY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11210 with Med13 domain of Kingdom Fungi
Unable to open file!