<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11208

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMGSPEETWSIFLQKCLVQRIEVTEFKDLASLLVARIPIAEPTLLDLLLACPAATGLKFDPLLPLYLDSLCRAGVIRPSIMLAALLKHASIRDQQNGSRSQPQKQDNKPGPASGVCTFMTDIKVLQNLMMLVSTGVLPKSTAEAAAMYAAIVDWIMALVDWHNNTSDEEQQTGGLITCPDAISLFESLGILLAALSGVKRGLDVLSHNNHEALRIKIGKALSSYLPLCDRISLPLRTRLDGLQKEFGLYGEPTRKPMEVTMIDSINVNALEFEASVMDGPVINSRAGLYIYINAMLVGRPLVDDGMLINYLNNRYGGNYEFLVEEVITAAFDILSNAMYRNESSRTMFLFRSFLVNKLPSFFAAMSATSMVPMEMCIRNALGRIDPNAFPSFSQMFSMQGSTVLSDVRQEFLFACALHRLIPESSIERLLGENPMQTLPVGGQYMKDELVAQINANPERADQLINEVESMDGNAGTIVGAITEVMHNLCTQKETMTLKNICNSLSRRPQALDVILLFRSPKQVLQPICSLLDSWHWDEDQSENQPVYDEFGSILLLVLAFKYRYDLTPFDLGVTSPGSFILRLLDRASCNQKLDDLSEQQNKNLGGWIGALFIAEGISEETMSACSPQEFYQLVSTLFSQSLGACEAGKLEFETLKGGFEYLLEPFLLPSLVVALTWLGNHIWESESDATIPLRALYSLVKPPSISGEAEAIHRTVLNITAQTLEEQLKDVRARHPTRSDIKPILDALEPYVSFQRIGACRRSELDTWTTHANSGLLGSIRSTFQSLVLWSANPEITISPHSYTHRQLLAGIHILGSARVLPALVDEVKLQTETGSGDIALDIAATMICAPMAESFAVEQSAYHSHHHHHHHHHDSMKEPLPPCPVLTLRDVLKQQHNLIAKLAEKDPLRAQVLVRLFRRVNHLMLTTVPSQVQVEGTVPVVPVSNLDVSNIIQTMQLDGVDGSDAQMNLEPDGAENIDQMFDKAAAAAAAAAAAGIEHNTDGSVAAIGLDGTGAGLETSLDDMLTAADMAVGNPEFLDLDMEGMF
Length1045
PositionTail
OrganismPenicilliopsis zonata CBS 506.65
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicilliopsis.
Aromaticity0.06
Grand average of hydropathy0.021
Instability index49.05
Isoelectric point4.97
Molecular weight114821.46
Publications
PubMed=28196534

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11208
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.94|      15|      17|      16|      32|       1
---------------------------------------------------------------------------
   18-   32 (24.24/19.48)	QRIEVTEFKDLASLL
   34-   48 (24.70/12.07)	ARIPIAEPTLLDLLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.46|      16|      17|     986|    1001|       2
---------------------------------------------------------------------------
  986- 1001 (25.50/16.86)	AAAA.AAAAAGIEHNTD
 1005- 1021 (20.97/12.45)	AAIGlDGTGAGLETSLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     172.92|      54|      65|      50|     103|       3
---------------------------------------------------------------------------
   50-  103 (91.26/53.32)	CPAATGLK.FDPLLPLYLDSLCRAGVIRPSIMLAALLK.HASIRDQQNGSRSQPQK
  115-  170 (81.65/47.00)	CTFMTDIKvLQNLMMLVSTGVLPKSTAEAAAMYAAIVDwIMALVDWHNNTSDEEQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.57|      12|      17|     279|     292|       4
---------------------------------------------------------------------------
  279-  292 (14.23/17.71)	PVINsRaGLYI.YIN
  299-  311 (18.34/10.15)	PLVD.D.GMLInYLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.23|      15|      19|     756|     772|       5
---------------------------------------------------------------------------
  756-  772 (23.83/25.96)	IGACRRS..ELDTWTthAN
  776-  792 (21.40/14.08)	LGSIRSTfqSLVLWS..AN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.48|      24|      68|     606|     633|       6
---------------------------------------------------------------------------
  606-  633 (33.73/38.13)	WIGAlFIAEGISEETMSAcspQEFYQLV
  676-  699 (44.75/31.44)	WLGN.HIWESESDATIPL...RALYSLV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11208 with Med5 domain of Kingdom Fungi
Unable to open file!