Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MATLTQDQIKTLEQTRQRLTQLTRSLGSLVASLNQSDPLPSWTSLQSQASIISNNLLSASEQLSANQDLLSSIVAYPGPEYPASTQARSTLEQLLRTKLDPRVDDWVGRGRTQASGVGDSEAADMAELWAWAPIEANQEARRRNWGGNFTLEEREMGIENVVTGLKRELEDDDDEEDEEDEDEDDDEDRDGGNAAEGEMEIVGAHRRSGGGLEFDLAVPPKMMAPEVPLDGILRFMTMGQAPKQR |
Length | 245 |
Position | Head |
Organism | Penicilliopsis zonata CBS 506.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicilliopsis. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.727 |
Instability index | 56.96 |
Isoelectric point | 4.27 |
Molecular weight | 27043.38 |
Publications | PubMed=28196534 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11207 No repeats found |
MoRF Sequence | Start | Stop |
1) EVPLDGILRFMTMGQAPKQR 2) GEMEIVGAHRRSG 3) GLEFDLAV | 226 197 211 | 245 209 218 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab