<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11187
Description |
Uncharacterized protein |
Sequence | MSLTNPPSSSGPLTAISRPTAASVSQNLSLKRSLQAAVDEGIESRKPPGSGYTSKVRVRDRYHIVGFISSGTYGRVYKALAKNGRKGEFAIKKFKPDKEGEHIQYTGLSQSAIREMSLCSELDHPNVVQLEEIILEDKCIFMVFEYTEHDLLQIIHHHTTPHRHAIPAPMVRSIMFQLLNGLFYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIEIMGFPRKETWPGLVSMPEYSQLQSLALSRGHGHFNRPSNLEGWYTGCLKNNGYSTTSNAGTPGADGYDLLSRLLEYDPTKRITAKEALEHPYFQNGGPIPANCFEGFEGKYPHRRVTQDDNDMRTGSLPGTKRSGLPDDSLMGRAAKRLKE |
Length | 449 |
Position | Kinase |
Organism | Aspergillus wentii DTO 134E9 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Cremei.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.399 |
Instability index | 39.82 |
Isoelectric point | 9.26 |
Molecular weight | 50291.05 |
Publications | PubMed=28196534
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11187
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.80| 14| 29| 155| 168| 4
---------------------------------------------------------------------------
155- 168 (28.13/20.02) IHHHTTPHRHAIPA
185- 198 (26.66/18.60) LHTNWVLHRDLKPA
---------------------------------------------------------------------------
|