<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11182
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLGYLSTYHDNSPTIPPPQVPDAAPALAKIPKNSSAPPAPAGVPAAAQASPPPPQSAQLARGASETGQGGEVVDPNLPPAPDSPRTFASRQRELARDLIIKEQQIEYLISVLPGIGSSEAEQESKIRELEKELRGVEEEREQKAKELKKLRRRLETALGAVETGIYGNRGHLMG |
Length | 195 |
Position | Middle |
Organism | Aspergillus wentii DTO 134E9 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Cremei.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.531 |
Instability index | 64.05 |
Isoelectric point | 5.34 |
Molecular weight | 20951.40 |
Publications | PubMed=28196534
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11182
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.29| 31| 33| 89| 119| 1
---------------------------------------------------------------------------
89- 119 (55.89/31.11) QGGEVVDPNLPPAPDSPRTFASRQRELARDL
124- 154 (47.40/25.32) QQIEYLISVLPGIGSSEAEQESKIRELEKEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.70| 13| 20| 41| 53| 3
---------------------------------------------------------------------------
41- 53 (23.23/ 9.16) VPDAAPALAKIPK
64- 76 (25.47/10.62) VPAAAQASPPPPQ
---------------------------------------------------------------------------
|