Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDGQDKPERVPRARNEIDYKLLLDFARRISKYNIEAAADAAAGMTKKGHAIPGKDTEMGGTNANGAQSGSPDAEPVAAVTKDATSWLDESANMTRQVYMLPYPMEDRIRMGLMGQIQLAAAEGRPGFDSDNEVERLIREAEGVGAADAVAPAPVAEETKRVNEAAMAAAHAGSAAATKVSVAPAPKPKAALDLDLYDPDEDED |
Length | 203 |
Position | Middle |
Organism | Aspergillus versicolor CBS 583.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.526 |
Instability index | 40.60 |
Isoelectric point | 4.63 |
Molecular weight | 21494.72 |
Publications | PubMed=28196534 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11175 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.03| 24| 29| 125| 153| 1 --------------------------------------------------------------------------- 130- 153 (40.91/26.28) DNEVERLIREAEGVGAADA....VAPAP 158- 185 (35.12/12.08) TKRVNEAAMAAAHAGSAAAtkvsVAPAP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AMAAAHAGSAAATKVSVAPAPKPKAALDLDLYDPDEDED 2) RARNEIDYK | 165 12 | 203 20 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab