<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11174

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMAGTQDPSALEEILWRSPPHIQMMGGYLHSNNILFYFAESPFFDATSNNASLAIQANYNEAFRHFVETREAFEGRLKTMQGLEFIVGYDPLQAAAGSNAQFAHEPSNVWVIRKQMRRKRSGFEDEVGVLATFFVVGDCIYMAPSAASILGNRILSAVTSLSSLMKTASTLPNFTPSHGHTYLPPVPKSTDAGQLGVQTQTSKENTPMPDDTTNKTQSFTGTQADTSSSVSDMMTLAESFNLLARYGDEFMDETPLVGEPGSFILSRAGDTDRGATSKQQQHTSTAAPGRIGTPQTKIDTPGKFTDKSSTAEEPKRKKKSKPGS
Length323
PositionHead
OrganismAspergillus versicolor CBS 583.65
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes.
Aromaticity0.08
Grand average of hydropathy-0.483
Instability index42.97
Isoelectric point6.00
Molecular weight35124.84
Publications
PubMed=28196534

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP11174
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.89|      33|      67|     159|     192|       1
---------------------------------------------------------------------------
  159-  192 (53.51/39.02)	SLSSLMKTASTLpNFTPSHGHTYLPPVPKSTDAG
  228-  260 (57.38/36.62)	SVSDMMTLAESF.NLLARYGDEFMDETPLVGEPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.04|      19|      32|     270|     288|       2
---------------------------------------------------------------------------
  270-  288 (32.52/22.59)	TDRGATSKQQQHTSTAAPG
  304-  322 (31.52/21.65)	TDKSSTAEEPKRKKKSKPG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP11174 with Med6 domain of Kingdom Fungi

Unable to open file!