<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11172
Description |
Mediator of RNA polymerase II transcription subunit 5 |
Sequence | MAIRTTKSKQAQAQAQWKTFFHRCLLHHIDAAEFRELSKLLFQRYPINDAPLMDALLATRAVASAVKWDPLLPLYIDSLCKMGYVKISTVLTCLLKCSSVRDKSVSGAEAASDGDADATSASAKQKEDSASKEKCYTLMTDNRVVQDVMLAISTGATAKMPLLEVIHAFSAVADWVLAIVGWHNGLLGAGQPVGMMGTPDGVLLFESVGILFAALAGTAKGLEVLSADSHEALKVRLGQALSACLPLCEDVSPPLRNRLDALQKEFNLYGQPPSKLDVSMMDNVNVNALNFEASVMDGPTINSRAGLYVYINAMLVGRPLVDDAILLNYLLNRYAGHYETLIEEIITASFDVLSNAMYRTESSRTMLLLRSFLVDKLPPFFSAMLSVSMVTLPMEVCISHALGRIDPNTFPSFSQMFSMQGNTPLSDVRQEFLFSCASHKLIPEASIERLLGENPMQTLPVGGSFVKDELVAQINANHERAEQLIGDIESTEGNAGAIVGAITDVMHNLCIQKETMTLKNICNSLSRRPQSLDIMLLFRSPKQILQPLCALLDAWHWDEDQGESQPVYDEFGSILLLVLTFKYRYDLRPFDLGITSNNSFILKLIERGSSSLKLDELNEKQNKNLGEWIAALFIAEGISEETMSACSPQEFYMLVSTLFRQSLGACEAGKLEFDTLKGGFEYLLEPFLLPSLVVALIWLGNHIWESEQDPTIPLKTLQSLVTPSSISGEAREIHLTVLNITARSLEEKLKDVRTRHSNRTDIKPILDALEPCLSFQRTGSCHKSELDPWTTHTPGGLLGSIRNTFQSLVLWSTSPGVSMAPPSYTHRQITTAIRTLGATRVLTALLDELLKLQTESTNTNANTSDLALDIAATLISAPLAESYTVDQSTHHPPSASSKEPTPRCAPLTLRDALNLVHENIPKLSEKDPLRAEVAVRLYRRVNTLLALPAHHDPNLDMNMGVNMNMNNIIDNMNLDVGDVNVDTDNTGQNMNMDMNLNEQGQGQGQNVTDPEHANLNQIMGDAAAAVGMNMDMNNMNNMNVDVNIGSGGDGMEGLGLGVGEGDQSIDDVLNAAEMNPEFLDLDMEGMF |
Length | 1087 |
Position | Tail |
Organism | Aspergillus versicolor CBS 583.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.063 |
Instability index | 41.79 |
Isoelectric point | 4.88 |
Molecular weight | 119151.94 |
Publications | PubMed=28196534
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364142
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11172
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.72| 19| 19| 957| 975| 1
---------------------------------------------------------------------------
957- 975 (39.40/20.47) MN.....MGVNMNMN........NIID....NMNLD
988- 1018 (22.26/ 8.83) QN.....MNMDMNLNeqgqgqgqNVTDpehaNLNQI
1019- 1041 (31.06/14.81) MGdaaaaVGMNMDMN........N.MN....NMNVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.99| 16| 19| 236| 254| 3
---------------------------------------------------------------------------
236- 254 (21.71/22.59) RLgQALSACLPLCEdvSPP
258- 273 (30.28/17.40) RL.DALQKEFNLYG..QPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 135.46| 32| 68| 821| 852| 4
---------------------------------------------------------------------------
821- 852 (48.36/30.82) PPSYTHRQITTAIRTLG.ATRVLTALLDELLKL
853- 885 (38.18/22.67) QTESTNTNANTSDLALDiAATLISAPLAESYTV
892- 923 (48.92/31.27) PPSASSKEPTPRCAPLT.LRDALNLVHENIPKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.56| 16| 19| 779| 795| 6
---------------------------------------------------------------------------
779- 795 (29.18/21.03) GSCHKS..ELDPWTThTPG
799- 816 (25.37/12.81) GSIRNTfqSLVLWST.SPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.22| 12| 19| 18| 34| 7
---------------------------------------------------------------------------
18- 32 (18.11/26.66) KTFFHRcllHHIDAA
39- 50 (22.10/ 9.75) KLLFQR...YPINDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.33| 14| 19| 641| 654| 8
---------------------------------------------------------------------------
641- 654 (27.13/15.34) ETMSAC..SPQEFYML
661- 676 (20.20/ 9.71) QSLGACeaGKLEFDTL
---------------------------------------------------------------------------
|