<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11172

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMAIRTTKSKQAQAQAQWKTFFHRCLLHHIDAAEFRELSKLLFQRYPINDAPLMDALLATRAVASAVKWDPLLPLYIDSLCKMGYVKISTVLTCLLKCSSVRDKSVSGAEAASDGDADATSASAKQKEDSASKEKCYTLMTDNRVVQDVMLAISTGATAKMPLLEVIHAFSAVADWVLAIVGWHNGLLGAGQPVGMMGTPDGVLLFESVGILFAALAGTAKGLEVLSADSHEALKVRLGQALSACLPLCEDVSPPLRNRLDALQKEFNLYGQPPSKLDVSMMDNVNVNALNFEASVMDGPTINSRAGLYVYINAMLVGRPLVDDAILLNYLLNRYAGHYETLIEEIITASFDVLSNAMYRTESSRTMLLLRSFLVDKLPPFFSAMLSVSMVTLPMEVCISHALGRIDPNTFPSFSQMFSMQGNTPLSDVRQEFLFSCASHKLIPEASIERLLGENPMQTLPVGGSFVKDELVAQINANHERAEQLIGDIESTEGNAGAIVGAITDVMHNLCIQKETMTLKNICNSLSRRPQSLDIMLLFRSPKQILQPLCALLDAWHWDEDQGESQPVYDEFGSILLLVLTFKYRYDLRPFDLGITSNNSFILKLIERGSSSLKLDELNEKQNKNLGEWIAALFIAEGISEETMSACSPQEFYMLVSTLFRQSLGACEAGKLEFDTLKGGFEYLLEPFLLPSLVVALIWLGNHIWESEQDPTIPLKTLQSLVTPSSISGEAREIHLTVLNITARSLEEKLKDVRTRHSNRTDIKPILDALEPCLSFQRTGSCHKSELDPWTTHTPGGLLGSIRNTFQSLVLWSTSPGVSMAPPSYTHRQITTAIRTLGATRVLTALLDELLKLQTESTNTNANTSDLALDIAATLISAPLAESYTVDQSTHHPPSASSKEPTPRCAPLTLRDALNLVHENIPKLSEKDPLRAEVAVRLYRRVNTLLALPAHHDPNLDMNMGVNMNMNNIIDNMNLDVGDVNVDTDNTGQNMNMDMNLNEQGQGQGQNVTDPEHANLNQIMGDAAAAVGMNMDMNNMNNMNVDVNIGSGGDGMEGLGLGVGEGDQSIDDVLNAAEMNPEFLDLDMEGMF
Length1087
PositionTail
OrganismAspergillus versicolor CBS 583.65
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes.
Aromaticity0.06
Grand average of hydropathy-0.063
Instability index41.79
Isoelectric point4.88
Molecular weight119151.94
Publications
PubMed=28196534

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11172
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.72|      19|      19|     957|     975|       1
---------------------------------------------------------------------------
  957-  975 (39.40/20.47)	MN.....MGVNMNMN........NIID....NMNLD
  988- 1018 (22.26/ 8.83)	QN.....MNMDMNLNeqgqgqgqNVTDpehaNLNQI
 1019- 1041 (31.06/14.81)	MGdaaaaVGMNMDMN........N.MN....NMNVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.99|      16|      19|     236|     254|       3
---------------------------------------------------------------------------
  236-  254 (21.71/22.59)	RLgQALSACLPLCEdvSPP
  258-  273 (30.28/17.40)	RL.DALQKEFNLYG..QPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     135.46|      32|      68|     821|     852|       4
---------------------------------------------------------------------------
  821-  852 (48.36/30.82)	PPSYTHRQITTAIRTLG.ATRVLTALLDELLKL
  853-  885 (38.18/22.67)	QTESTNTNANTSDLALDiAATLISAPLAESYTV
  892-  923 (48.92/31.27)	PPSASSKEPTPRCAPLT.LRDALNLVHENIPKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.56|      16|      19|     779|     795|       6
---------------------------------------------------------------------------
  779-  795 (29.18/21.03)	GSCHKS..ELDPWTThTPG
  799-  816 (25.37/12.81)	GSIRNTfqSLVLWST.SPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.22|      12|      19|      18|      34|       7
---------------------------------------------------------------------------
   18-   32 (18.11/26.66)	KTFFHRcllHHIDAA
   39-   50 (22.10/ 9.75)	KLLFQR...YPINDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.33|      14|      19|     641|     654|       8
---------------------------------------------------------------------------
  641-  654 (27.13/15.34)	ETMSAC..SPQEFYML
  661-  676 (20.20/ 9.71)	QSLGACeaGKLEFDTL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11172 with Med5 domain of Kingdom Fungi
Unable to open file!