<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11170
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATIGYLTTYHDNSPATTPQNPTSAPALAKIQKNSTNPPIAASAAAILNSSTSQASPSGGPGGPGAATTPGPNPSNIGGEAAGAVGEEGLPPRPDSPRTFAARQRELARDLVIKEQQIEYLISVLPGIGSSEAEQEKRIRELERELRGVEEERQRRVKELRVLRKRVEGVLGAVDNGIYGAPK |
Length | 202 |
Position | Middle |
Organism | Aspergillus versicolor CBS 583.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.509 |
Instability index | 56.20 |
Isoelectric point | 5.97 |
Molecular weight | 21421.74 |
Publications | PubMed=28196534
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP11170
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.80| 15| 16| 151| 166| 1
---------------------------------------------------------------------------
151- 166 (21.47/18.86) EAEQEKRIRELeRELR
169- 183 (25.33/17.11) EEERQRRVKEL.RVLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.01| 17| 18| 76| 93| 2
---------------------------------------------------------------------------
76- 93 (32.35/16.63) PSGGPGGP.GAATTPgPNP
96- 113 (26.66/ 9.48) IGGEAAGAvGEEGLP.PRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.27| 14| 18| 32| 48| 3
---------------------------------------------------------------------------
32- 48 (16.94/18.53) NSPaTTPqnPTSAPALA
52- 65 (24.33/12.86) KNS.TNP..PIAASAAA
---------------------------------------------------------------------------
|