Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAQQHPDQAQPPATLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISKSGNDSDVNDDSSDPEAEAFAAYLAYLYSYWKTPEYSQFLTHPGATLRALRLLQEETFRRDIIRPQVIEGLAGMDVNGEQSGPAESGDQDGQPKKTDQGV |
Length | 150 |
Position | Middle |
Organism | Aspergillus versicolor CBS 583.65 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.591 |
Instability index | 45.72 |
Isoelectric point | 4.46 |
Molecular weight | 16564.02 |
Publications | PubMed=28196534 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP11167 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 172.42| 54| 81| 6| 66| 1 --------------------------------------------------------------------------- 6- 66 (88.56/60.43) PDQAQ....PPATLTNPRFTLELEFVSSLANPYYLSHLAvtypnllGISKSGNDS...DVNDDSSDPE 84- 144 (83.86/45.34) PEYSQflthPGATLRALRLLQEETFRRDIIRPQVIEGLA.......GMDVNGEQSgpaESGDQDGQPK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKTDQGV 2) SDPEAEAFAAYLAYLYSYWK | 144 63 | 150 82 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab