<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11166
| Description |
Uncharacterized protein |
| Sequence | MSLTNPPSSGPLTATSRPVAAAVSQNLSLKRSLQQTAVEENINSRRQPGTGYTSKVRVRDRYHIVGFISSGTYGRVYKALGKNGQKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMALCSELDHANVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHPIPAAMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTSGGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIDIMGLPHKDNWPGIVSMPEYSQLQSLTMSRAPNHISRTSNLQSWYQNCLKNGGYSATSSVGTPGDDGFDLLSRLLDYDPTRRITAAEALEHPYFTNGGPIPANCFDGSEGKYPHRRVTQDDNDIRTGSLPGTKRSGLPDDSLMGRASKRLKE |
| Length | 449 |
| Position | Kinase |
| Organism | Aspergillus versicolor CBS 583.65 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.357 |
| Instability index | 45.83 |
| Isoelectric point | 9.23 |
| Molecular weight | 50093.75 |
| Publications | PubMed=28196534
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11166
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.41| 20| 85| 239| 262| 1
---------------------------------------------------------------------------
239- 262 (27.77/28.44) RAPELLmgSRhyTPAVDLWAVGCI
327- 346 (39.64/23.07) RAPNHI..SR..TSNLQSWYQNCL
---------------------------------------------------------------------------
|