<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11157

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGVVMDNANIGGLRHGTGNTYPQDGLSHPRGEVVQFNGANAQDGPVHVNGVEKNASQSRSVETVSANHALRVTKGPPELPHITQGFFPFTKLVNRSVQQCWNDLSDLITEMAEMQVNSHEFHPSTAPTTGKSPGNQSPGNIRKKLRILEFSHAKRAEFIKLLVLSQWSRQAADVSKLIDIQNFIRTRHQAYMNALQWVGDMKRDLVQAQVANPDLKTALEVLSRGKVASMSDLGYKPPRRLTVRGTLKKLQKINRLIGARLVVQEEIPPPFRNYRVHDGRVTFGVPGEFELDLSIGEENENSQFFFVDIRFLFSPSPPILKGRLLNELEMTINDVLQNSGLTGCFDLLHNLVLTNKVNILFKQATEMARGPWSECLRVELLHRTLVVQYWTLKPGAKSWLEIGIRSGHRKSDSESPGLPSLKFRWMRDGGEVPCEDIAFDAENLSMEIVLRSVIALHVSHILSSAYNKIRQSSLFSTGFLSLRAHLTRTEPGDCQLDAQLTETRHLRVSIEPMSGMSIFSATPTVSDRSDLERNPERSSVEDIVSRVARIRCNAAIEEIESKVKMLGFEPLNPRAWKVDIRRIFPPNVLRFTLFSHQLWGRNWIVAATSSMDSDSWWVVQLRPTAPAKGPPVPHGSGRGQSVLRSAQVVTDSFFPARYDIDDAYLANLGHSLSGILAIHSNARYLSDLQSIKFHPPPHKLKIEPDLRVPDILVRYDVSTLPSVFRAAMPVKAKKKSLIRDTIRLAFHGVDPREKCAIMVAYGNLVDSTATLGPLISSWDRSLVFQKGGSGFAMRLLAPAGHPVIASLLENLQRLECVLSVLESLQRKKVEIRTFSLSSISFVYGPERDLAASLNIHLSRNESLMELSPTELASRSESLFGLRLGIQFGLQNPHRRIQDSLASSLNRSSTEAGLETVVELLTLTLPLMRALDQLMANPSYSGPLRLHVTVRNAKTYQIHYPGDEARFQLVAASHQNRLVWVLKDANSQGNSKNNDSITARLRQTLYTSKGDGWKGLETGVVAEVNQVGNLLRELENCFVASRADPAVSGSNNPGTSALETEKGTADGAKISLSDPLTTMPNDKSSLSQADTAAQKEDIIMID
Length1102
PositionTail
OrganismAspergillus tubingensis (strain CBS 134.48)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.06
Grand average of hydropathy-0.267
Instability index48.00
Isoelectric point9.09
Molecular weight122279.19
Publications
PubMed=28196534

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP11157
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.88|      29|      34|     863|     896|       1
---------------------------------------------------------------------------
  863-  896 (40.94/33.06)	SLmelsPTELaSRSESLFGLRLGIQ.FGLQNPHRR
  900-  929 (41.95/21.38)	SL....ASSL.NRSSTEAGLETVVElLTLTLPLMR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.66|      19|      34|     684|     702|       2
---------------------------------------------------------------------------
  684-  702 (36.19/24.84)	RY.LSDLQSIKFHPPPHKLK
  715-  734 (26.46/16.02)	RYdVSTLPSVFRAAMPVKAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.36|      13|      34|     291|     303|       3
---------------------------------------------------------------------------
  291-  303 (21.46/14.64)	ELDLSIGEENENS
  328-  340 (21.90/15.09)	ELEMTINDVLQNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.31|      25|      30|     141|     168|       4
---------------------------------------------------------------------------
  141-  168 (36.40/38.45)	NIRKKLRILEFSHAKRAEFIKLLvlsQW
  174-  198 (43.91/36.05)	DVSKLIDIQNFIRTRHQAYMNAL...QW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.65|      18|      42|     474|     492|       5
---------------------------------------------------------------------------
  474-  492 (28.58/21.29)	SLFS.TGFLSLRAHLTRtEP
  518-  536 (29.07/16.64)	SIFSaTPTVSDRSDLER.NP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.38|      14|     552|      75|      89|       7
---------------------------------------------------------------------------
   75-   89 (28.05/20.40)	KGPPeLPH..............ITQGFFP
  629-  656 (22.33/10.80)	KGPP.VPHgsgrgqsvlrsaqvVTDSFFP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.45|      20|      32|     945|     976|       8
---------------------------------------------------------------------------
  585-  606 (35.35/10.73)	FPPNVLRFTLF..SHQlwGR.NWIV
  960-  982 (29.10/37.84)	YPGDEARFQLVaaSHQ..NRlVWVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.64|      26|      44|     993|    1018|      16
---------------------------------------------------------------------------
  993- 1018 (45.09/30.28)	NNDSITARLRQTLYTSKGDGWKGLET
 1035- 1060 (44.54/29.82)	ENCFVASRADPAVSGSNNPGTSALET
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11157 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SGSNNPGTSALETEKGTADGAKISLSDPLTTMPNDKSSLSQADTA
2) VMDNANIGGLRHGTGNTYPQDGLSHPRGEVVQFNGANAQDGPVHVNGVEKNASQSRSVETVSANHALRVTKG
1048
5
1092
76










Molecular Recognition Features






MoRF SequenceStartStop




NANANA