<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11134

Description Uncharacterized protein
SequenceMDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDRDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDFAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDKDWEDIKKMPEHSTLIKDFRRNTYTNCSLIKYMEKHKVKPDSKTFHLLQKLLTMDPIKRISSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDNSHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYQNPGPSTSQPQSSMGYTSTSQQPPQYSHQTHRY
Length416
PositionKinase
OrganismXenopus laevis (African clawed frog)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia> Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
Aromaticity0.09
Grand average of hydropathy-0.775
Instability index38.37
Isoelectric point9.14
Molecular weight47762.81
Publications
PubMed=27762356

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP11134
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      36|     151|     165|       2
---------------------------------------------------------------------------
  151-  165 (26.77/15.67)	DLKPANILVMGEGPE
  189-  203 (28.67/17.22)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.21|      16|      17|     271|     286|       3
---------------------------------------------------------------------------
  271-  286 (29.21/14.44)	DPIKRISSEQAMQDPY
  290-  305 (31.00/15.66)	DPLPTSDVFAGCQIPY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP11134 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDNSHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYQNPGPSTSQPQSSMGYTSTSQQPPQYSHQTHRY
305
416










Molecular Recognition Features






MoRF SequenceStartStop




NANANA