<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11134
| Description |
Uncharacterized protein |
| Sequence | MDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDRDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDFAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDKDWEDIKKMPEHSTLIKDFRRNTYTNCSLIKYMEKHKVKPDSKTFHLLQKLLTMDPIKRISSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDNSHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYQNPGPSTSQPQSSMGYTSTSQQPPQYSHQTHRY |
| Length | 416 |
| Position | Kinase |
| Organism | Xenopus laevis (African clawed frog) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.775 |
| Instability index | 38.37 |
| Isoelectric point | 9.14 |
| Molecular weight | 47762.81 |
| Publications | PubMed=27762356
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11134
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 36| 151| 165| 2
---------------------------------------------------------------------------
151- 165 (26.77/15.67) DLKPANILVMGEGPE
189- 203 (28.67/17.22) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.21| 16| 17| 271| 286| 3
---------------------------------------------------------------------------
271- 286 (29.21/14.44) DPIKRISSEQAMQDPY
290- 305 (31.00/15.66) DPLPTSDVFAGCQIPY
---------------------------------------------------------------------------
|