<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11132
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAVPEKSTKERLESLLDDLEVLSREVIETLALSRSQKLSQPGEENQILELLIQKDGEFQELMKVAFSQGKTHQEMQVLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGVISSEELIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMSNLPTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSMNMLPPNHSNEFLMESLGPNKENEEDVEVMSTDSSSSSSDSD |
Length | 252 |
Position | Middle |
Organism | Xenopus laevis (African clawed frog) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.623 |
Instability index | 55.64 |
Isoelectric point | 4.83 |
Molecular weight | 28056.28 |
Publications | PubMed=27762356
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP11132
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.76| 27| 33| 35| 63| 1
---------------------------------------------------------------------------
35- 63 (41.94/30.71) SQklSQPGEENQILELLIQK.DGEFQELMK
67- 94 (41.82/24.76) SQ..GKTHQEMQVLEKEVEKrDSDIQQLQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.48| 13| 36| 172| 184| 2
---------------------------------------------------------------------------
172- 184 (25.02/16.91) MSNLPTNGVNGHL
211- 223 (26.46/18.25) MNMLPPNHSNEFL
---------------------------------------------------------------------------
|