<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11116
| Description |
Uncharacterized protein (Fragment) |
| Sequence | KPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYTNSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSDQALQDLYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKTEKNQQTQNQHQQQTATQKQATVQQQQQQQNSSQTNGTGGTAGATLQHSQDSSLNQGPQNKKPRMGPSANNSGGSSLMPSDYQHSSSRLGYQSNVQGSSQPQNAMGYTTTSQQSSQYHQSHRY |
| Length | 338 |
| Position | Kinase |
| Organism | Xenopus laevis (African clawed frog) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.884 |
| Instability index | 55.44 |
| Isoelectric point | 7.29 |
| Molecular weight | 38344.34 |
| Publications | PubMed=27762356
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11116
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.43| 15| 15| 223| 237| 1
---------------------------------------------------------------------------
223- 237 (26.44/11.34) QNQHQQQTATQKQAT
239- 253 (25.00/10.39) QQQQQQQNSSQTNGT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.80| 15| 15| 304| 318| 2
---------------------------------------------------------------------------
280- 299 (17.82/ 6.61) MGPSANNSGGSslMPsdyQH
304- 318 (27.98/14.35) LGYQSNVQGSS..QP...QN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.53| 14| 16| 160| 175| 3
---------------------------------------------------------------------------
160- 175 (20.95/17.46) LQKL.LTMDPTKriTSD
178- 192 (22.58/12.04) LQDLyFQEDPLP..TSD
---------------------------------------------------------------------------
|