<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP11115
| Description |
Uncharacterized protein |
| Sequence | MSTPPLSGPGMGAAAGPGAFQGAQANSAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTVTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLEPVPIEQLIPYVEEEYSKHDDRGIASQLRFASEEKREILEVNKKLKQKNQQLKQIMDQLRNLIWDINSMLAMRN |
| Length | 184 |
| Position | Head |
| Organism | Xenopus laevis (African clawed frog) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.470 |
| Instability index | 43.69 |
| Isoelectric point | 8.44 |
| Molecular weight | 20958.86 |
| Publications | PubMed=27762356
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP11115
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 73| 81| 101| 1
---------------------------------------------------------------------------
81- 101 (35.37/25.03) KLQEHLRQLSILFRKLR.LVYD
154- 175 (32.88/22.81) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|